Lineage for d1rz8b1 (1rz8 B:1-113)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1287638Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1287745Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88544] (37 PDB entries)
  8. 1287778Domain d1rz8b1: 1rz8 B:1-113 [98139]
    Other proteins in same PDB: d1rz8a1, d1rz8a2, d1rz8b2, d1rz8c1, d1rz8c2, d1rz8d2
    part of anti HIV-1 gp120-reactive Fab 17B

Details for d1rz8b1

PDB Entry: 1rz8 (more details), 2.3 Å

PDB Description: crystal structure of human anti-hiv-1 gp120-reactive antibody 17b
PDB Compounds: (B:) Fab 17b heavy chain

SCOPe Domain Sequences for d1rz8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rz8b1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
evqlvesgaevkkpgssvkvsckasgdtfirysftwvrqapgqglewmgriitildvahy
aphlqgrvtitadkststvylelrnlrsddtavyfcagvyegeadegeydnngflkhwgq
gtlvtvss

SCOPe Domain Coordinates for d1rz8b1:

Click to download the PDB-style file with coordinates for d1rz8b1.
(The format of our PDB-style files is described here.)

Timeline for d1rz8b1: