Lineage for d1rz8a1 (1rz8 A:1-109)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2353665Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2353828Species Human (Homo sapiens), cluster 3.2 [TaxId:9606] [88523] (31 PDB entries)
  8. 2353863Domain d1rz8a1: 1rz8 A:1-109 [98137]
    Other proteins in same PDB: d1rz8a2, d1rz8b1, d1rz8b2, d1rz8c2, d1rz8d1, d1rz8d2
    part of anti HIV-1 gp120 Fab 17B

Details for d1rz8a1

PDB Entry: 1rz8 (more details), 2.3 Å

PDB Description: crystal structure of human anti-hiv-1 gp120-reactive antibody 17b
PDB Compounds: (A:) Fab 17b light chain

SCOPe Domain Sequences for d1rz8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rz8a1 b.1.1.1 (A:1-109) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]}
divmtqspatlsvspgeratlscrasesvssdlawyqqkpgqaprlliygastratgvpa
rfsgsgsgaeftltisslqsedfavyycqqynnwpprytfgqgtrleikrt

SCOPe Domain Coordinates for d1rz8a1:

Click to download the PDB-style file with coordinates for d1rz8a1.
(The format of our PDB-style files is described here.)

Timeline for d1rz8a1: