Lineage for d1rz3a_ (1rz3 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474782Family c.37.1.6: Phosphoribulokinase/pantothenate kinase [52584] (6 proteins)
  6. 2474783Protein Hypothetical protein rbstp0775 [102358] (1 species)
    structural similarity to PanK
  7. 2474784Species Bacillus stearothermophilus [TaxId:1422] [102359] (1 PDB entry)
  8. 2474785Domain d1rz3a_: 1rz3 A: [98132]
    structural genomics
    complexed with act, ca

Details for d1rz3a_

PDB Entry: 1rz3 (more details), 1.9 Å

PDB Description: Structure of a Possible Uridine Kinase from Bacillus stearothermophilus
PDB Compounds: (A:) hypothetical protein RBSTP0775

SCOPe Domain Sequences for d1rz3a_:

Sequence, based on SEQRES records: (download)

>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]}
melrdridflcktilaiktagrlvlgidglsrsgkttlanqlsqtlreqgisvcvfhmdd
hiverakryhtgneewfeyyylqwdvewlthqlfrqlkashqltlpfydhetdthskrtv
ylsdsdmimiegvflqrkewrpffdfvvyldcpreirfarendqvkqniqkfinrywkae
dyyleteepikradvvfd

Sequence, based on observed residues (ATOM records): (download)

>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]}
melrdridflcktilaiktagrlvlgidglsrsgkttlanqlsqtlreqgisvcvfhmdd
hiverakryhtgneewfeyyylqwdvewlthqlfrqlkashqltlpfydhetdthskrtv
ylsdsdmimiegvflqrkewrpffdfvvyldcpniqkfinrywkaedyyleteepikrad
vvfd

SCOPe Domain Coordinates for d1rz3a_:

Click to download the PDB-style file with coordinates for d1rz3a_.
(The format of our PDB-style files is described here.)

Timeline for d1rz3a_: