![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
![]() | Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) ![]() related to the ferredoxin reductase-like FAD-binding domain |
![]() | Family b.45.1.2: NADH:FMN oxidoreductase-like [50482] (5 proteins) different dimerization mode than in the PNP-oxidase like family |
![]() | Protein Phenol 2-hydroxylase component B (PheA2) [101798] (1 species) utilizes FAD rather than FMN |
![]() | Species Geobacillus thermoglucosidasius [TaxId:1426] [101799] (2 PDB entries) |
![]() | Domain d1rz1h_: 1rz1 H: [98131] complexed with fad, nad |
PDB Entry: 1rz1 (more details), 2.1 Å
SCOPe Domain Sequences for d1rz1h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rz1h_ b.45.1.2 (H:) Phenol 2-hydroxylase component B (PheA2) {Geobacillus thermoglucosidasius [TaxId: 1426]} mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa gdhtlfigevtdikiteqdpllffsgkyhqlaq
Timeline for d1rz1h_: