Lineage for d1rz1g_ (1rz1 G:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1792693Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 1792694Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 1792827Family b.45.1.2: NADH:FMN oxidoreductase-like [50482] (5 proteins)
    different dimerization mode than in the PNP-oxidase like family
  6. 1792837Protein Phenol 2-hydroxylase component B (PheA2) [101798] (1 species)
    utilizes FAD rather than FMN
  7. 1792838Species Geobacillus thermoglucosidasius [TaxId:1426] [101799] (2 PDB entries)
  8. 1792845Domain d1rz1g_: 1rz1 G: [98130]
    complexed with fad, nad

Details for d1rz1g_

PDB Entry: 1rz1 (more details), 2.1 Å

PDB Description: reduced flavin reductase phea2 in complex with nad
PDB Compounds: (G:) phenol 2-hydroxylase component B

SCOPe Domain Sequences for d1rz1g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rz1g_ b.45.1.2 (G:) Phenol 2-hydroxylase component B (PheA2) {Geobacillus thermoglucosidasius [TaxId: 1426]}
mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
gdhtlfigevtdikiteqdpllffsgkyhqlaq

SCOPe Domain Coordinates for d1rz1g_:

Click to download the PDB-style file with coordinates for d1rz1g_.
(The format of our PDB-style files is described here.)

Timeline for d1rz1g_: