Lineage for d1rz1f_ (1rz1 F:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 375965Fold b.45: FMN-binding split barrel [50474] (1 superfamily)
    barrel; n=6, S=10; greek-key
  4. 375966Superfamily b.45.1: FMN-binding split barrel [50475] (2 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 375986Family b.45.1.2: NADH:FMN oxidoreductase-like [50482] (4 proteins)
    different dimerization mode than in the PNP-oxidase like family
  6. 375996Protein Phenol 2-hydroxylase component B (PheA2) [101798] (1 species)
    utilizes FAD rather than FMN
  7. 375997Species Geobacillus thermoglucosidasius [TaxId:1426] [101799] (2 PDB entries)
  8. 376011Domain d1rz1f_: 1rz1 F: [98129]

Details for d1rz1f_

PDB Entry: 1rz1 (more details), 2.1 Å

PDB Description: reduced flavin reductase phea2 in complex with nad

SCOP Domain Sequences for d1rz1f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rz1f_ b.45.1.2 (F:) Phenol 2-hydroxylase component B (PheA2) {Geobacillus thermoglucosidasius}
mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
gdhtlfigevtdikiteqdpllffsgkyhqlaq

SCOP Domain Coordinates for d1rz1f_:

Click to download the PDB-style file with coordinates for d1rz1f_.
(The format of our PDB-style files is described here.)

Timeline for d1rz1f_: