Lineage for d1rz0h_ (1rz0 H:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 669990Fold b.45: Split barrel-like [50474] (2 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 669991Superfamily b.45.1: FMN-binding split barrel [50475] (3 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 670091Family b.45.1.2: NADH:FMN oxidoreductase-like [50482] (5 proteins)
    different dimerization mode than in the PNP-oxidase like family
  6. 670101Protein Phenol 2-hydroxylase component B (PheA2) [101798] (1 species)
    utilizes FAD rather than FMN
  7. 670102Species Geobacillus thermoglucosidasius [TaxId:1426] [101799] (2 PDB entries)
  8. 670110Domain d1rz0h_: 1rz0 H: [98123]
    complexed with fad

Details for d1rz0h_

PDB Entry: 1rz0 (more details), 2.2 Å

PDB Description: flavin reductase phea2 in native state
PDB Compounds: (H:) phenol 2-hydroxylase component B

SCOP Domain Sequences for d1rz0h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rz0h_ b.45.1.2 (H:) Phenol 2-hydroxylase component B (PheA2) {Geobacillus thermoglucosidasius [TaxId: 1426]}
mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
gdhtlfigevtdikiteqdpllffsgkyhqlaq

SCOP Domain Coordinates for d1rz0h_:

Click to download the PDB-style file with coordinates for d1rz0h_.
(The format of our PDB-style files is described here.)

Timeline for d1rz0h_: