Lineage for d1rz0g_ (1rz0 G:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1317892Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 1317893Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 1318022Family b.45.1.2: NADH:FMN oxidoreductase-like [50482] (5 proteins)
    different dimerization mode than in the PNP-oxidase like family
  6. 1318032Protein Phenol 2-hydroxylase component B (PheA2) [101798] (1 species)
    utilizes FAD rather than FMN
  7. 1318033Species Geobacillus thermoglucosidasius [TaxId:1426] [101799] (2 PDB entries)
  8. 1318048Domain d1rz0g_: 1rz0 G: [98122]
    complexed with fad

Details for d1rz0g_

PDB Entry: 1rz0 (more details), 2.2 Å

PDB Description: flavin reductase phea2 in native state
PDB Compounds: (G:) phenol 2-hydroxylase component B

SCOPe Domain Sequences for d1rz0g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rz0g_ b.45.1.2 (G:) Phenol 2-hydroxylase component B (PheA2) {Geobacillus thermoglucosidasius [TaxId: 1426]}
mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
gdhtlfigevtdikiteqdpllffsgkyhqlaq

SCOPe Domain Coordinates for d1rz0g_:

Click to download the PDB-style file with coordinates for d1rz0g_.
(The format of our PDB-style files is described here.)

Timeline for d1rz0g_: