Class b: All beta proteins [48724] (174 folds) |
Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) related to the ferredoxin reductase-like FAD-binding domain |
Family b.45.1.2: NADH:FMN oxidoreductase-like [50482] (5 proteins) different dimerization mode than in the PNP-oxidase like family |
Protein Phenol 2-hydroxylase component B (PheA2) [101798] (1 species) utilizes FAD rather than FMN |
Species Geobacillus thermoglucosidasius [TaxId:1426] [101799] (2 PDB entries) |
Domain d1rz0g_: 1rz0 G: [98122] complexed with fad |
PDB Entry: 1rz0 (more details), 2.2 Å
SCOPe Domain Sequences for d1rz0g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rz0g_ b.45.1.2 (G:) Phenol 2-hydroxylase component B (PheA2) {Geobacillus thermoglucosidasius [TaxId: 1426]} mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa gdhtlfigevtdikiteqdpllffsgkyhqlaq
Timeline for d1rz0g_: