Lineage for d1rz0c_ (1rz0 C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2403705Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2403706Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2403847Family b.45.1.2: NADH:FMN oxidoreductase-like [50482] (5 proteins)
    different dimerization mode than in the PNP-oxidase like family
  6. 2403857Protein Phenol 2-hydroxylase component B (PheA2) [101798] (1 species)
    utilizes FAD rather than FMN
  7. 2403858Species Geobacillus thermoglucosidasius [TaxId:1426] [101799] (2 PDB entries)
  8. 2403869Domain d1rz0c_: 1rz0 C: [98118]
    complexed with fad

Details for d1rz0c_

PDB Entry: 1rz0 (more details), 2.2 Å

PDB Description: flavin reductase phea2 in native state
PDB Compounds: (C:) phenol 2-hydroxylase component B

SCOPe Domain Sequences for d1rz0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rz0c_ b.45.1.2 (C:) Phenol 2-hydroxylase component B (PheA2) {Geobacillus thermoglucosidasius [TaxId: 1426]}
mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
gdhtlfigevtdikiteqdpllffsgkyhqlaq

SCOPe Domain Coordinates for d1rz0c_:

Click to download the PDB-style file with coordinates for d1rz0c_.
(The format of our PDB-style files is described here.)

Timeline for d1rz0c_: