Lineage for d1rysb1 (1rys B:241-341)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 516579Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 516580Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (1 family) (S)
  5. 516581Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)
  6. 516582Protein DinB homolog (DBH) [100881] (2 species)
  7. 516587Species Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100882] (11 PDB entries)
  8. 516590Domain d1rysb1: 1rys B:241-341 [98113]
    Other proteins in same PDB: d1rysa2, d1rysb2

Details for d1rysb1

PDB Entry: 1rys (more details), 2.03 Å

PDB Description: replication of a cis-syn thymine dimer at atomic resolution

SCOP Domain Sequences for d1rysb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rysb1 d.240.1.1 (B:241-341) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus, DNA polymerase IV}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfi

SCOP Domain Coordinates for d1rysb1:

Click to download the PDB-style file with coordinates for d1rysb1.
(The format of our PDB-style files is described here.)

Timeline for d1rysb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rysb2