Lineage for d1ryna1 (1ryn A:1-193)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2125386Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2126575Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) (S)
  5. 2126576Family c.56.3.1: Peptidyl-tRNA hydrolase-like [53179] (3 protein domains)
    automatically mapped to Pfam PF01195
  6. 2126577Protein Chloroplast group II intron splicing factor Crs2 [102502] (1 species)
  7. 2126578Species Maize (Zea mays) [TaxId:4577] [102503] (3 PDB entries)
  8. 2126581Domain d1ryna1: 1ryn A:1-193 [98107]
    Other proteins in same PDB: d1ryna2

Details for d1ryna1

PDB Entry: 1ryn (more details), 1.75 Å

PDB Description: Structure of the Chloroplast Group II Intron Splicing Factor CRS2
PDB Compounds: (A:) protein CRS2

SCOPe Domain Sequences for d1ryna1:

Sequence, based on SEQRES records: (download)

>d1ryna1 c.56.3.1 (A:1-193) Chloroplast group II intron splicing factor Crs2 {Maize (Zea mays) [TaxId: 4577]}
eytpwliaglgnpgnkyygtrhnvgfemvdriaaeegitmntnqfksllgtgsigevpvl
vvkpqsymnysgeaigplaayyqvplrhilliyddtslpngvlrlqkkgghgrhnglqnv
iehldgrrefprlsigigsppgkmdprafllqkfsseervqidtaleqgvdavrtlvlkg
fsgsterfnlvqk

Sequence, based on observed residues (ATOM records): (download)

>d1ryna1 c.56.3.1 (A:1-193) Chloroplast group II intron splicing factor Crs2 {Maize (Zea mays) [TaxId: 4577]}
eytpwliaglgnpgnkyygtrhnvgfemvdriaaeegitmntnqfksllgtgsigevpvl
vvkpqsymnysgeaigplaayyqvplrhilliyddtslpngvlrlqkkrhnglqnviehl
dgrrefprlsigigsppgkmdprafllqkfsseervqidtaleqgvdavrtlvlkgfsgs
terfnlvqk

SCOPe Domain Coordinates for d1ryna1:

Click to download the PDB-style file with coordinates for d1ryna1.
(The format of our PDB-style files is described here.)

Timeline for d1ryna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ryna2