| Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.3: MoaD/ThiS [54285] (2 families) ![]() possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies |
| Family d.15.3.2: ThiS [54289] (3 proteins) |
| Protein Hypothetical protein MTH1743 [69664] (1 species) probable ThiS homologue |
| Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [69665] (1 PDB entry) |
| Domain d1ryja_: 1ryj A: [98104] structural genomics |
PDB Entry: 1ryj (more details)
SCOP Domain Sequences for d1ryja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ryja_ d.15.3.2 (A:) Hypothetical protein MTH1743 {Archaeon Methanobacterium thermoautotrophicum}
mvigmkftvitddgkkilesgaprrikdvlgeleipietvvvkkngqivideeeifdgdi
ievirviygg
Timeline for d1ryja_: