Lineage for d1ryja_ (1ryj A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 499486Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 499737Superfamily d.15.3: MoaD/ThiS [54285] (2 families) (S)
    possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies
  5. 499755Family d.15.3.2: ThiS [54289] (3 proteins)
  6. 499756Protein Hypothetical protein MTH1743 [69664] (1 species)
    probable ThiS homologue
  7. 499757Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [69665] (1 PDB entry)
  8. 499758Domain d1ryja_: 1ryj A: [98104]
    structural genomics

Details for d1ryja_

PDB Entry: 1ryj (more details)

PDB Description: solution nmr structure of protein mth1743 from methanobacterium thermoautotrophicum. ontario centre for structural proteomics target mth1743_1_70; northeast structural genomics consortium target tt526.

SCOP Domain Sequences for d1ryja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ryja_ d.15.3.2 (A:) Hypothetical protein MTH1743 {Archaeon Methanobacterium thermoautotrophicum}
mvigmkftvitddgkkilesgaprrikdvlgeleipietvvvkkngqivideeeifdgdi
ievirviygg

SCOP Domain Coordinates for d1ryja_:

Click to download the PDB-style file with coordinates for d1ryja_.
(The format of our PDB-style files is described here.)

Timeline for d1ryja_: