Lineage for d1ryha_ (1ryh A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 393753Family c.37.1.8: G proteins [52592] (37 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 394025Protein Rac [52595] (1 species)
  7. 394026Species Human (Homo sapiens) [TaxId:9606] [52596] (12 PDB entries)
  8. 394028Domain d1ryha_: 1ryh A: [98102]

Details for d1ryha_

PDB Entry: 1ryh (more details), 1.75 Å

PDB Description: Alternative Splicing of Rac1 Generates Rac1b, a Self-activating GTPase

SCOP Domain Sequences for d1ryha_:

Sequence, based on SEQRES records: (download)

>d1ryha_ c.37.1.8 (A:) Rac {Human (Homo sapiens)}
gsmqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdt
agqedydrlrplsypqtvgetygkditsrgkdkpiadvflicfslvspasfenvrakwyp
evrhhcpntpiilvgtkldlrddkdtieklkekkltpitypqglamakeigavkylecsa
ltqrglktvfdeairavlcpppv

Sequence, based on observed residues (ATOM records): (download)

>d1ryha_ c.37.1.8 (A:) Rac {Human (Homo sapiens)}
gsmqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdt
agiadvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlrddkdtieklke
kkltpitypqglamakeigavkylecsaltqrglktvfdeairavlcpppv

SCOP Domain Coordinates for d1ryha_:

Click to download the PDB-style file with coordinates for d1ryha_.
(The format of our PDB-style files is described here.)

Timeline for d1ryha_: