Lineage for d1ryba_ (1ryb A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2125386Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2126575Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) (S)
  5. 2126576Family c.56.3.1: Peptidyl-tRNA hydrolase-like [53179] (3 protein domains)
    automatically mapped to Pfam PF01195
  6. 2126577Protein Chloroplast group II intron splicing factor Crs2 [102502] (1 species)
  7. 2126578Species Maize (Zea mays) [TaxId:4577] [102503] (3 PDB entries)
  8. 2126579Domain d1ryba_: 1ryb A: [98098]

Details for d1ryba_

PDB Entry: 1ryb (more details), 1.7 Å

PDB Description: Crystal Structure of the Chloroplast Group II Intron Splicing Factor CRS2
PDB Compounds: (A:) crs2

SCOPe Domain Sequences for d1ryba_:

Sequence, based on SEQRES records: (download)

>d1ryba_ c.56.3.1 (A:) Chloroplast group II intron splicing factor Crs2 {Maize (Zea mays) [TaxId: 4577]}
ytpwliaglgnpgnkyygtrhnvgfemvdriaaeegitmntiqsksllgigsigevpvlv
vkpqsymnysgeaigplaayyqvplrhilliyddtslpngvlrlqkkgghgrhnglqnvi
ehldgrrefprlsigigsppgkmdprafllqkfsseervqidtaleqgvdavrtlvlkgf
sgsterfnlvq

Sequence, based on observed residues (ATOM records): (download)

>d1ryba_ c.56.3.1 (A:) Chloroplast group II intron splicing factor Crs2 {Maize (Zea mays) [TaxId: 4577]}
ytpwliaglgnpgnkyygtrhnvgfemvdriaaeegitmntiqsksllgigsigevpvlv
vkpqsymnysgeaigplaayyqvplrhilliyddtslpngvlrlqkkgghgrhnglqnvi
ehldgrrefprlsigigsppgkmdprafllqkfsseervqidtaleqgvdavrtlvlkge
rfnlvq

SCOPe Domain Coordinates for d1ryba_:

Click to download the PDB-style file with coordinates for d1ryba_.
(The format of our PDB-style files is described here.)

Timeline for d1ryba_: