![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.198: Secretion chaperone-like [69634] (5 superfamilies) alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta |
![]() | Superfamily d.198.1: Type III secretory system chaperone-like [69635] (3 families) ![]() |
![]() | Family d.198.1.1: Type III secretory system chaperone [69636] (10 proteins) the family sequences are very divergent |
![]() | Protein Surface presentation of antigens protein SpaK (Spa15) [102748] (2 species) |
![]() | Species Shigella flexneri [TaxId:623] [102749] (1 PDB entry) |
![]() | Domain d1ry9d_: 1ry9 D: [98097] complexed with cl |
PDB Entry: 1ry9 (more details), 1.82 Å
SCOPe Domain Sequences for d1ry9d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ry9d_ d.198.1.1 (D:) Surface presentation of antigens protein SpaK (Spa15) {Shigella flexneri [TaxId: 623]} msninlvqlvrdslftigcppsiitdldshsaitisldsmpainialvneqvmlwanfda psdvklqssaynilnlmlmnfsysinelvelhrsdeylqlrvvikddyvhdgivfaeilh efyqrmeilngvl
Timeline for d1ry9d_: