SCOPe 2.07: Domain d1ry9b_: 1ry9 B:

Lineage for d1ry9b_ (1ry9 B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
   alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.198.1: Type III secretory system chaperone-like [69635] (3 families)

5. Family d.198.1.1: Type III secretory system chaperone [69636] (10 proteins)
   the family sequences are very divergent

6. Protein Surface presentation of antigens protein SpaK (Spa15) [102748] (2 species)

7. Species Shigella flexneri [TaxId:623] [102749] (1 PDB entry)

8. Domain d1ry9b_: 1ry9 B: [98095]
   complexed with cl

Details for d1ry9b_

PDB Entry: 1ry9, 1.82 Å

PDB Description: spa15, a type iii secretion chaperone from shigella flexneri

PDB Compounds: (B:) Surface presentation of antigens protein spaK

SCOPe Domain Sequences for d1ry9b_:

Sequence; same for both SEQRES and ATOM records:

>d1ry9b_ d.198.1.1 (B:) Surface presentation of antigens protein SpaK (Spa15) {Shigella flexneri [TaxId: 623]}
msninlvqlvrdslftigcppsiitdldshsaitisldsmpainialvneqvmlwanfda
psdvklqssaynilnlmlmnfsysinelvelhrsdeylqlrvvikddyvhdgivfaeilh
efyqrmeilngvl

Timeline for d1ry9b_:

• d1ry9b_ first appeared in SCOP 1.67
  
• d1ry9b_ appears in SCOPe 2.06
  
• d1ry9b_ appears in the current release, SCOPe 2.08