Lineage for d1ry9b_ (1ry9 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005912Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 3005913Superfamily d.198.1: Type III secretory system chaperone-like [69635] (3 families) (S)
  5. 3005914Family d.198.1.1: Type III secretory system chaperone [69636] (10 proteins)
    the family sequences are very divergent
  6. 3005938Protein Surface presentation of antigens protein SpaK (Spa15) [102748] (2 species)
  7. 3005941Species Shigella flexneri [TaxId:623] [102749] (1 PDB entry)
  8. 3005943Domain d1ry9b_: 1ry9 B: [98095]
    complexed with cl

Details for d1ry9b_

PDB Entry: 1ry9 (more details), 1.82 Å

PDB Description: spa15, a type iii secretion chaperone from shigella flexneri
PDB Compounds: (B:) Surface presentation of antigens protein spaK

SCOPe Domain Sequences for d1ry9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ry9b_ d.198.1.1 (B:) Surface presentation of antigens protein SpaK (Spa15) {Shigella flexneri [TaxId: 623]}
msninlvqlvrdslftigcppsiitdldshsaitisldsmpainialvneqvmlwanfda
psdvklqssaynilnlmlmnfsysinelvelhrsdeylqlrvvikddyvhdgivfaeilh
efyqrmeilngvl

SCOPe Domain Coordinates for d1ry9b_:

Click to download the PDB-style file with coordinates for d1ry9b_.
(The format of our PDB-style files is described here.)

Timeline for d1ry9b_: