Lineage for d1ry9a_ (1ry9 A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 422531Fold d.198: Secretion chaperone-like [69634] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 422532Superfamily d.198.1: Type III secretory system chaperone [69635] (1 family) (S)
  5. 422533Family d.198.1.1: Type III secretory system chaperone [69636] (5 proteins)
    the family sequences are very divergent
  6. 422542Protein Surface presentation of antigens protein SpaK (Spa15) [102748] (1 species)
  7. 422543Species Shigella flexneri [TaxId:623] [102749] (1 PDB entry)
  8. 422544Domain d1ry9a_: 1ry9 A: [98094]

Details for d1ry9a_

PDB Entry: 1ry9 (more details), 1.82 Å

PDB Description: spa15, a type iii secretion chaperone from shigella flexneri

SCOP Domain Sequences for d1ry9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ry9a_ d.198.1.1 (A:) Surface presentation of antigens protein SpaK (Spa15) {Shigella flexneri}
msninlvqlvrdslftigcppsiitdldshsaitisldsmpainialvneqvmlwanfda
psdvklqssaynilnlmlmnfsysinelvelhrsdeylqlrvvikddyvhdgivfaeilh
efyqrmeilngvl

SCOP Domain Coordinates for d1ry9a_:

Click to download the PDB-style file with coordinates for d1ry9a_.
(The format of our PDB-style files is described here.)

Timeline for d1ry9a_: