Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein Fibroblast growth factor receptor, FGFR [49179] (4 species) |
Species Human (Homo sapiens), FGFR3c [TaxId:9606] [101514] (1 PDB entry) |
Domain d1ry7b1: 1ry7 B:150-248 [98092] Other proteins in same PDB: d1ry7a_ |
PDB Entry: 1ry7 (more details), 3.2 Å
SCOPe Domain Sequences for d1ry7b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ry7b1 b.1.1.4 (B:150-248) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR3c [TaxId: 9606]} apywtrpermdkkllavpaantvrfrcpaagnptpsiswlkngrefrgehriggiklrhq qwslvmesvvpsdrgnytcvvenkfgsirqtytldvler
Timeline for d1ry7b1: