Lineage for d1ry6a_ (1ry6 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111568Family c.37.1.9: Motor proteins [52641] (5 protein domains)
  6. 2111569Protein Kinesin [52646] (7 species)
  7. 2111608Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [102371] (1 PDB entry)
  8. 2111609Domain d1ry6a_: 1ry6 A: [98090]
    complexed with so4

Details for d1ry6a_

PDB Entry: 1ry6 (more details), 1.6 Å

PDB Description: Crystal Structure of Internal Kinesin Motor Domain
PDB Compounds: (A:) internal kinesin

SCOPe Domain Sequences for d1ry6a_:

Sequence, based on SEQRES records: (download)

>d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
mikvvvrkrplselekkkkdsdiitvknnctlyideprykvdmtkyierhefivdkvfdd
tvdnftvyentikpliidlyengcvcscfaygqtgsgktytmlgsqpygqsdtpgifqya
agdiftflniydkdntkgifisfyeiycgklydllqkrkmvaalengkkevvvkdlkilr
vltkeelilkmidgvllrkigvnsqndessrshailnidlkdinkntslgkiafidlags
ergadtvsqnkqtqtdganinrsllalkeciramdsdknhipfrdseltkvlrdifvgks
ksimianisptiscceqtlntlryssrvkn

Sequence, based on observed residues (ATOM records): (download)

>d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
mikvvvrkrplselekkkkdsdiitvknnctlyideprykvdmtkyierhefivdkvfdd
tvdnftvyentikpliidlyengcvcscfaygqtgsgktytmlgsqpygqsdtpgifqya
agdiftflniydkdntkgifisfyeiycgklydllqkkevvvkdlkilrvltkeelilkm
idgvllrkigvnsqndessrshailnidlkdinkntslgkiafidlagsergadtvsqnk
qtqtdganinrsllalkeciramdsdknhipfrdseltkvlrdifvgksksimianispt
iscceqtlntlryssrvkn

SCOPe Domain Coordinates for d1ry6a_:

Click to download the PDB-style file with coordinates for d1ry6a_.
(The format of our PDB-style files is described here.)

Timeline for d1ry6a_: