Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d1ry5m_ (1ry5 M:)

  1. Root: SCOP 1.75B
  2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
  5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 protein domains)
    L and M are probably related to each other
  6. Protein M (medium) subunit [81481] (3 species)
  7. Species Rhodobacter sphaeroides [TaxId:1063] [81479] (46 PDB entries)
    Uniprot P02953
  8. Domain d1ry5m_: 1ry5 M: [98089]
    Other proteins in same PDB: d1ry5h1, d1ry5h2, d1ry5l_
    complexed with bcl, bph, cdl, fe2, gol, k, lda, po4, spo, u10; mutant

Details for d1ry5m_

PDB Entry: 1ry5 (more details)
PDB Description: photosynthetic reaction center mutant from rhodobacter sphae with asp l213 replaced with asn
PDB Compounds: (M:) reaction center protein m chain

SCOP Domain Sequences for d1ry5m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ry5m_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
h

SCOP Domain Coordinates for d1ry5m_:

Click to download the PDB-style file with coordinates for d1ry5m_.
(The format of our PDB-style files is described here.)

Timeline for d1ry5m_:

d1ry5m_ appears in SCOP 1.75A


d1ry5m_
(click for larger image)


d1ry5m_ in context of chain



d1ry5m_ in context of PDB
Domains from other chains:
d1ry5h1, d1ry5h2, d1ry5l_

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu