SCOPe 2.07: Domain d1ry5h1: 1ry5 H:36-249

Lineage for d1ry5h1 (1ry5 H:36-249)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)

6. Protein Photosynthetic reaction centre [50348] (4 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (87 PDB entries)
   Uniprot P11846

8. Domain d1ry5h1: 1ry5 H:36-249 [98086]
   Other proteins in same PDB: d1ry5h2, d1ry5l_, d1ry5m_
   complexed with bcl, bph, cdl, fe2, gol, k, lda, po4, spo, u10; mutant

Details for d1ry5h1

PDB Entry: 1ry5, 2.1 Å

PDB Description: photosynthetic reaction center mutant from rhodobacter sphaeroides with asp l213 replaced with asn

PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d1ry5h1:

Sequence; same for both SEQRES and ATOM records:

>d1ry5h1 b.41.1.1 (H:36-249) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrk

Timeline for d1ry5h1:

• d1ry5h1 first appeared in SCOP 1.67
  
• d1ry5h1 appears in SCOPe 2.06
  
• d1ry5h1 appears in the current release, SCOPe 2.08