Lineage for d1ry2a_ (1ry2 A:)

  1. Root: SCOP 1.67
  2. 423625Class e: Multi-domain proteins (alpha and beta) [56572] (40 folds)
  3. 425092Fold e.23: Acetyl-CoA synthetase-like [56800] (1 superfamily)
    4 domains: (1&2) duplication: share the same alpha/beta fold; (3) beta-barrel; (4) alpha+beta
  4. 425093Superfamily e.23.1: Acetyl-CoA synthetase-like [56801] (1 family) (S)
  5. 425094Family e.23.1.1: Acetyl-CoA synthetase-like [56802] (4 proteins)
  6. 425095Protein Acetyl-CoA synthetase [90093] (2 species)
  7. 425096Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [103405] (1 PDB entry)
  8. 425097Domain d1ry2a_: 1ry2 A: [98083]
    complexed with amp

Details for d1ry2a_

PDB Entry: 1ry2 (more details), 2.3 Å

PDB Description: crystal structure of yeast acetyl-coenzyme a synthetase in complex with amp

SCOP Domain Sequences for d1ry2a_:

Sequence, based on SEQRES records: (download)

>d1ry2a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast (Saccharomyces cerevisiae)}
qdyqrlhkesiedpakffgskatqflnwskpfdkvfipdpktgrpsfqnnawflngqlna
cyncvdrhalktpnkkaiifegdepgqgysitykelleevcqvaqvltysmgvrkgdtva
vympmvpeaiitllaisrigaihsvvfagfssnslrdrindgdskvvittdesnrggkvi
etkrivddalretpgvrhvlvyrktnnpsvafhaprdldwatekkkyktyypctpvdsed
plfllytsgstgapkgvqhstagyllgalltmrytfdthqedvfftagdigwitghtyvv
ygpllygcatlvfegtpaypnysrywdiidehkvtqfyvaptalrllkragdsyienhsl
kslrclgsvgepiaaevwewysekigkneipivdtywqtesgshlvtplaggvtpmkpgs
asfpffgidavvldpntgeelntshaegvlavkaawpsfartiwknhdryldtylnpypg
yyftgdgaakdkdgyiwilgrvddvvnvsghrlstaeieaaiiedpivaecavvgfnddl
tgqavaafvvlknksswstatddelqdikkhlvftvrkdigpfaapkliilvddlpktrs
gkimrrilrkilagesdqlgdvstlsnpgivrhlidsvkl

Sequence, based on observed residues (ATOM records): (download)

>d1ry2a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast (Saccharomyces cerevisiae)}
qdyqrlhkesiedpakffgskatqflnwskpfdkvfipdpktgrpsfqnnawflngqlna
cyncvdrhalktpnkkaiifegdepgqgysitykelleevcqvaqvltysmgvrkgdtva
vympmvpeaiitllaisrigaihsvvfagfssnslrdrindgdskvvittdesnrggkvi
etkrivddalretpgvrhvlvyrktnnpsvafhaprdldwatekkkyktyypctpvdsed
plfllytsgstgapkgvqhstagyllgalltmrytfdthqedvfftagdigwitghtyvv
ygpllygcatlvfegtpaypnysrywdiidehkvtqfyvaptalrllkragdsyienhsl
kslrclgsvgepiaaevwewysekigkneipivdtywqtesgshlvtplaggvtpmkpgs
asfpffgidavvldpntgeelntshaegvlavkaawpsfartiwknhdryldtylnpypg
yyftgdgaakdkdgyiwilgrvddvvnvsghrlstaeieaaiiedpivaecavvgfnddl
tgqavaafvvlklqdikkhlvftvrkdigpfaapkliilvddlpktrsgkimrrilrkil
anpgivrhlidsvkl

SCOP Domain Coordinates for d1ry2a_:

Click to download the PDB-style file with coordinates for d1ry2a_.
(The format of our PDB-style files is described here.)

Timeline for d1ry2a_: