Lineage for d1ry1c_ (1ry1 C:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3045549Fold i.22: Signal recognition particle (SRP) complex [103691] (1 superfamily)
  4. 3045550Superfamily i.22.1: Signal recognition particle (SRP) complex [103692] (1 family) (S)
  5. 3045551Family i.22.1.1: Signal recognition particle (SRP) complex [103693] (1 protein)
  6. 3045552Protein Signal recognition particle (SRP) complex [103694] (1 species)
  7. 3045553Species interspecies complex [103695] (1 PDB entry)
  8. 3045555Domain d1ry1c_: 1ry1 C: [98071]

Details for d1ry1c_

PDB Entry: 1ry1 (more details), 12 Å

PDB Description: structure of the signal recognition particle interacting with the elongation-arrested ribosome
PDB Compounds: (C:) srp9

SCOPe Domain Sequences for d1ry1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ry1c_ i.22.1.1 (C:) Signal recognition particle (SRP) complex {interspecies complex}
qtweefsraaeklyladpmkarvvlkyrhsdgnlcvkvtddlvclvyktdqaqdvkkiek
fhsqlmrlmva

SCOPe Domain Coordinates for d1ry1c_:

Click to download the PDB-style file with coordinates for d1ry1c_.
(The format of our PDB-style files is described here.)

Timeline for d1ry1c_: