Lineage for d1rxza2 (1rxz A:123-245)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 418559Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 418560Superfamily d.131.1: DNA clamp [55979] (2 families) (S)
  5. 418591Family d.131.1.2: DNA polymerase processivity factor [55983] (3 proteins)
    duplication: consists of two domains of this fold
  6. 418613Protein Proliferating cell nuclear antigen (PCNA) [55989] (4 species)
  7. 418614Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [103254] (3 PDB entries)
  8. 418618Domain d1rxza2: 1rxz A:123-245 [98068]
    complexed with a FEN-1 peptide, chain B

Details for d1rxza2

PDB Entry: 1rxz (more details), 2 Å

PDB Description: C-terminal region of A. fulgidus FEN-1 complexed with A. fulgidus PCNA

SCOP Domain Sequences for d1rxza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rxza2 d.131.1.2 (A:123-245) Proliferating cell nuclear antigen (PCNA) {Archaeon Archaeoglobus fulgidus}
pelelpakivmdagefkkaiaaadkisdqvifrsdkegfrieakgdvdsivfhmteteli
efnggearsmfsvdylkefckvagsgdlltihlgtnypvrlvfelvggrakveyilapri
ese

SCOP Domain Coordinates for d1rxza2:

Click to download the PDB-style file with coordinates for d1rxza2.
(The format of our PDB-style files is described here.)

Timeline for d1rxza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rxza1