Lineage for d1rxza2 (1rxz A:123-245)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species)
  7. Species Archaeoglobus fulgidus [TaxId:2234] [103254] (3 PDB entries)
  8. Domain d1rxza2: 1rxz A:123-245 [98068]
    complexed with a FEN-1 peptide, chain B
    protein/DNA complex

Details for d1rxza2

PDB Entry: 1rxz (more details), 2 Å

PDB Description: C-terminal region of A. fulgidus FEN-1 complexed with A. fulgidus PCNA
PDB Compounds: (A:) DNA polymerase sliding clamp

SCOPe Domain Sequences for d1rxza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rxza2 d.131.1.2 (A:123-245) Proliferating cell nuclear antigen (PCNA) {Archaeoglobus fulgidus [TaxId: 2234]}
pelelpakivmdagefkkaiaaadkisdqvifrsdkegfrieakgdvdsivfhmteteli
efnggearsmfsvdylkefckvagsgdlltihlgtnypvrlvfelvggrakveyilapri
ese

SCOPe Domain Coordinates for d1rxza2 are not available.

Timeline for d1rxza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rxza1