Lineage for d1rxza1 (1rxz A:1-122)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2583354Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2583355Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2583540Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. 2583562Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species)
  7. 2583563Species Archaeoglobus fulgidus [TaxId:2234] [103254] (3 PDB entries)
  8. 2583566Domain d1rxza1: 1rxz A:1-122 [98067]
    complexed with a FEN-1 peptide, chain B
    protein/DNA complex

Details for d1rxza1

PDB Entry: 1rxz (more details), 2 Å

PDB Description: C-terminal region of A. fulgidus FEN-1 complexed with A. fulgidus PCNA
PDB Compounds: (A:) DNA polymerase sliding clamp

SCOPe Domain Sequences for d1rxza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rxza1 d.131.1.2 (A:1-122) Proliferating cell nuclear antigen (PCNA) {Archaeoglobus fulgidus [TaxId: 2234]}
midvimtgellktvtraivalvsearihflekglhsravdpanvamvivdipkdsfevyn
ideektigvdmdrifdisksistkdlvelivedestlkvkfgsveykvalidpsairkep
ri

SCOPe Domain Coordinates for d1rxza1:

Click to download the PDB-style file with coordinates for d1rxza1.
(The format of our PDB-style files is described here.)

Timeline for d1rxza1: