Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family) complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
Family c.56.2.1: Purine and uridine phosphorylases [53168] (6 proteins) |
Protein Uridine phosphorylase [53176] (1 species) |
Species Escherichia coli [TaxId:562] [53177] (6 PDB entries) also includes the PDB entry (1rxs) where protein chains are designated by both upper case and lower case letters creating problems with its processing and presentation in SCOP |
Domain d1rxyb_: 1rxy B: [98066] |
PDB Entry: 1rxy (more details), 1.7 Å
SCOP Domain Sequences for d1rxyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rxyb_ c.56.2.1 (B:) Uridine phosphorylase {Escherichia coli} sdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpvi vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf aplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkgs meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk ivveaarrll
Timeline for d1rxyb_: