Lineage for d1rxxd_ (1rxx D:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 417970Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 417971Superfamily d.126.1: Pentein [55909] (4 families) (S)
  5. 418001Family d.126.1.4: Arginine deiminase [103232] (1 protein)
    functionally related to the amidinotransferase, similar active sites
  6. 418002Protein Arginine deiminase [103233] (2 species)
  7. 418008Species Pseudomonas aeruginosa [TaxId:287] [103234] (1 PDB entry)
  8. 418012Domain d1rxxd_: 1rxx D: [98064]

Details for d1rxxd_

PDB Entry: 1rxx (more details), 2.45 Å

PDB Description: Structure of arginine deiminase

SCOP Domain Sequences for d1rxxd_:

Sequence, based on SEQRES records: (download)

>d1rxxd_ d.126.1.4 (D:) Arginine deiminase {Pseudomonas aeruginosa}
tklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrer
gidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeylig
gvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpmywpar
rqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerss
rqaigqvaqslfakgaaervivaglpksraamhldtvfsfcdrdlvtvfpevvkeivpfs
lrpdpsspygmnirreektflevvaeslglkklrvvetggnsfaaereqwddgnnvvcle
pgvvvgydrntytntllrkagvevitisaselgrgrggghcmtcpivrdpid

Sequence, based on observed residues (ATOM records): (download)

>d1rxxd_ d.126.1.4 (D:) Arginine deiminase {Pseudomonas aeruginosa}
tklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrer
gidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeylig
gvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpmywpar
rqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerss
rqaigqvaqslfakgaaervivaglpkaamhldtvfsfcdrdlvtvfpevvkeivpfslr
pdpsspygmnirreektflevvaeslglkklrvvetgeqwddgnnvvclepgvvvgydrn
tytntllrkagvevitisaselgrgrggghcmtcpivrdpid

SCOP Domain Coordinates for d1rxxd_:

Click to download the PDB-style file with coordinates for d1rxxd_.
(The format of our PDB-style files is described here.)

Timeline for d1rxxd_: