Lineage for d1rxxd_ (1rxx D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974297Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 2974298Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 2974335Family d.126.1.4: Arginine deiminase [103232] (1 protein)
    functionally related to the amidinotransferase, similar active sites
  6. 2974336Protein Arginine deiminase [103233] (2 species)
  7. 2974342Species Pseudomonas aeruginosa [TaxId:287] [103234] (5 PDB entries)
  8. 2974354Domain d1rxxd_: 1rxx D: [98064]

Details for d1rxxd_

PDB Entry: 1rxx (more details), 2.45 Å

PDB Description: Structure of arginine deiminase
PDB Compounds: (D:) Arginine deiminase

SCOPe Domain Sequences for d1rxxd_:

Sequence, based on SEQRES records: (download)

>d1rxxd_ d.126.1.4 (D:) Arginine deiminase {Pseudomonas aeruginosa [TaxId: 287]}
tklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrer
gidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeylig
gvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpmywpar
rqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerss
rqaigqvaqslfakgaaervivaglpksraamhldtvfsfcdrdlvtvfpevvkeivpfs
lrpdpsspygmnirreektflevvaeslglkklrvvetggnsfaaereqwddgnnvvcle
pgvvvgydrntytntllrkagvevitisaselgrgrggghcmtcpivrdpid

Sequence, based on observed residues (ATOM records): (download)

>d1rxxd_ d.126.1.4 (D:) Arginine deiminase {Pseudomonas aeruginosa [TaxId: 287]}
tklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrer
gidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeylig
gvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpmywpar
rqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerss
rqaigqvaqslfakgaaervivaglpkaamhldtvfsfcdrdlvtvfpevvkeivpfslr
pdpsspygmnirreektflevvaeslglkklrvvetgeqwddgnnvvclepgvvvgydrn
tytntllrkagvevitisaselgrgrggghcmtcpivrdpid

SCOPe Domain Coordinates for d1rxxd_:

Click to download the PDB-style file with coordinates for d1rxxd_.
(The format of our PDB-style files is described here.)

Timeline for d1rxxd_: