Lineage for d1rxxb_ (1rxx B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2580827Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 2580828Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 2580865Family d.126.1.4: Arginine deiminase [103232] (1 protein)
    functionally related to the amidinotransferase, similar active sites
  6. 2580866Protein Arginine deiminase [103233] (2 species)
  7. 2580872Species Pseudomonas aeruginosa [TaxId:287] [103234] (5 PDB entries)
  8. 2580882Domain d1rxxb_: 1rxx B: [98062]

Details for d1rxxb_

PDB Entry: 1rxx (more details), 2.45 Å

PDB Description: Structure of arginine deiminase
PDB Compounds: (B:) Arginine deiminase

SCOPe Domain Sequences for d1rxxb_:

Sequence, based on SEQRES records: (download)

>d1rxxb_ d.126.1.4 (B:) Arginine deiminase {Pseudomonas aeruginosa [TaxId: 287]}
tklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrer
gidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeylig
gvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpmywpar
rqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerss
rqaigqvaqslfakgaaervivaglpksraamhldtvfsfcdrdlvtvfpevvkeivpfs
lrpdpsspygmnirreektflevvaeslglkklrvvetggnsfaaereqwddgnnvvcle
pgvvvgydrntytntllrkagvevitisaselgrgrggghcmtcpivrdpidy

Sequence, based on observed residues (ATOM records): (download)

>d1rxxb_ d.126.1.4 (B:) Arginine deiminase {Pseudomonas aeruginosa [TaxId: 287]}
tklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrer
gidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeylig
gvaaddlpaseganilkmyreylghfllpplpntqftrdttcwiyggvtlnpmywparrq
etllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerssrq
aigqvaqslfakgaaervivaglpkaamhldtvfsfcdrdlvtvfpevvkeivpfslrpd
psspygmnirreektflevvaeslglkklrvvetggnreqwddgnnvvclepgvvvgydr
ntytntllrkagvevitisaselgrgrggghcmtcpivrdpidy

SCOPe Domain Coordinates for d1rxxb_:

Click to download the PDB-style file with coordinates for d1rxxb_.
(The format of our PDB-style files is described here.)

Timeline for d1rxxb_: