Lineage for d1rxvb1 (1rxv B:220-323)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 539305Fold a.60: SAM domain-like [47768] (14 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 539589Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (1 family) (S)
  5. 539590Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins)
  6. 539597Protein Flap endonuclease-1 (Fen-1 nuclease) [47815] (4 species)
  7. 539598Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [101255] (2 PDB entries)
  8. 539601Domain d1rxvb1: 1rxv B:220-323 [98057]
    Other proteins in same PDB: d1rxva2, d1rxvb2

Details for d1rxvb1

PDB Entry: 1rxv (more details), 2.5 Å

PDB Description: Crystal Structure of A. Fulgidus FEN-1 bound to DNA

SCOP Domain Sequences for d1rxvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rxvb1 a.60.7.1 (B:220-323) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Archaeoglobus fulgidus}
ltreqlidiailvgtdynegvkgvgvkkalnyiktygdifralkalkvnidhveeirnff
lnppvtddyriefrepdfekaieflceehdfsrervekaleklk

SCOP Domain Coordinates for d1rxvb1:

Click to download the PDB-style file with coordinates for d1rxvb1.
(The format of our PDB-style files is described here.)

Timeline for d1rxvb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rxvb2