| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (2 families) ![]() |
| Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins) |
| Protein Flap endonuclease-1 (Fen-1 nuclease) [47815] (5 species) |
| Species Archaeoglobus fulgidus [TaxId:2234] [101255] (2 PDB entries) |
| Domain d1rxvb1: 1rxv B:220-323 [98057] Other proteins in same PDB: d1rxva2, d1rxvb2 protein/DNA complex |
PDB Entry: 1rxv (more details), 2.5 Å
SCOPe Domain Sequences for d1rxvb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rxvb1 a.60.7.1 (B:220-323) Flap endonuclease-1 (Fen-1 nuclease) {Archaeoglobus fulgidus [TaxId: 2234]}
ltreqlidiailvgtdynegvkgvgvkkalnyiktygdifralkalkvnidhveeirnff
lnppvtddyriefrepdfekaieflceehdfsrervekaleklk
Timeline for d1rxvb1: