Lineage for d1rxva2 (1rxv A:4-219)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2529111Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 2529112Superfamily c.120.1: PIN domain-like [88723] (3 families) (S)
  5. 2529173Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins)
    contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold
  6. 2529180Protein Flap endonuclease-1 (Fen-1 nuclease) [53052] (5 species)
  7. 2529181Species Archaeoglobus fulgidus [TaxId:2234] [102272] (2 PDB entries)
  8. 2529183Domain d1rxva2: 1rxv A:4-219 [98056]
    Other proteins in same PDB: d1rxva1, d1rxvb1
    protein/DNA complex

Details for d1rxva2

PDB Entry: 1rxv (more details), 2.5 Å

PDB Description: Crystal Structure of A. Fulgidus FEN-1 bound to DNA
PDB Compounds: (A:) Flap structure-specific endonuclease

SCOPe Domain Sequences for d1rxva2:

Sequence, based on SEQRES records: (download)

>d1rxva2 c.120.1.2 (A:4-219) Flap endonuclease-1 (Fen-1 nuclease) {Archaeoglobus fulgidus [TaxId: 2234]}
digdlfereeveleyfsgkkiavdafntlyqfisiirqpdgtplkdsqgritshlsgily
rvsnmvevgirpvfvfdgeppefkkaeieerkkrraeaeemwiaalqagdkdakkyaqaa
grvdeyivdsaktllsymgipfvdapsegeaqaaymaakgdveytgsqdydsllfgsprl
arnlaitgkrklpgknvyvdvkpeiiilesnlkrlg

Sequence, based on observed residues (ATOM records): (download)

>d1rxva2 c.120.1.2 (A:4-219) Flap endonuclease-1 (Fen-1 nuclease) {Archaeoglobus fulgidus [TaxId: 2234]}
digdlfereeveleyfsgkkiavdafntlyqfisiirqpdgtplkdsqgritshlsgily
rvsnmvevgirpvfvfdgeppefkkaeieerkkrraeaeemwiaalqagdkdakkyaqaa
grvdeyivdsaktllsymgipfvdapsegeaqaaymaakgdveytgsqdydsllfgsprl
arnlaikpeiiilesnlkrlg

SCOPe Domain Coordinates for d1rxva2:

Click to download the PDB-style file with coordinates for d1rxva2.
(The format of our PDB-style files is described here.)

Timeline for d1rxva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rxva1