![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.120: PIN domain-like [88722] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.120.1: PIN domain-like [88723] (3 families) ![]() |
![]() | Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins) contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold |
![]() | Protein Flap endonuclease-1 (Fen-1 nuclease) [53052] (5 species) |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [102272] (2 PDB entries) |
![]() | Domain d1rxva2: 1rxv A:4-219 [98056] Other proteins in same PDB: d1rxva1, d1rxvb1 protein/DNA complex |
PDB Entry: 1rxv (more details), 2.5 Å
SCOPe Domain Sequences for d1rxva2:
Sequence, based on SEQRES records: (download)
>d1rxva2 c.120.1.2 (A:4-219) Flap endonuclease-1 (Fen-1 nuclease) {Archaeoglobus fulgidus [TaxId: 2234]} digdlfereeveleyfsgkkiavdafntlyqfisiirqpdgtplkdsqgritshlsgily rvsnmvevgirpvfvfdgeppefkkaeieerkkrraeaeemwiaalqagdkdakkyaqaa grvdeyivdsaktllsymgipfvdapsegeaqaaymaakgdveytgsqdydsllfgsprl arnlaitgkrklpgknvyvdvkpeiiilesnlkrlg
>d1rxva2 c.120.1.2 (A:4-219) Flap endonuclease-1 (Fen-1 nuclease) {Archaeoglobus fulgidus [TaxId: 2234]} digdlfereeveleyfsgkkiavdafntlyqfisiirqpdgtplkdsqgritshlsgily rvsnmvevgirpvfvfdgeppefkkaeieerkkrraeaeemwiaalqagdkdakkyaqaa grvdeyivdsaktllsymgipfvdapsegeaqaaymaakgdveytgsqdydsllfgsprl arnlaikpeiiilesnlkrlg
Timeline for d1rxva2: