SCOP 1.69: Domain d1rxva1: 1rxv A:220-323

Lineage for d1rxva1 (1rxv A:220-323)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.60: SAM domain-like [47768] (13 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (1 family)

5. Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins)

6. Protein Flap endonuclease-1 (Fen-1 nuclease) [47815] (4 species)

7. Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [101255] (2 PDB entries)

8. Domain d1rxva1: 1rxv A:220-323 [98055]
   Other proteins in same PDB: d1rxva2, d1rxvb2

Details for d1rxva1

PDB Entry: 1rxv, 2.5 Å

PDB Description: Crystal Structure of A. Fulgidus FEN-1 bound to DNA

SCOP Domain Sequences for d1rxva1:

Sequence; same for both SEQRES and ATOM records:

>d1rxva1 a.60.7.1 (A:220-323) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Archaeoglobus fulgidus}
ltreqlidiailvgtdynegvkgvgvkkalnyiktygdifralkalkvnidhveeirnff
lnppvtddyriefrepdfekaieflceehdfsrervekaleklk

Timeline for d1rxva1:

• d1rxva1 first appeared in SCOP 1.67
  
• d1rxva1 appears in SCOP 1.71
  
• d1rxva1 appears in the current release, SCOPe 2.08