Lineage for d1rxun_ (1rxu N:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1173024Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1173040Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 1173041Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 1173372Protein Uridine phosphorylase [53176] (2 species)
  7. 1173373Species Escherichia coli [TaxId:562] [53177] (15 PDB entries)
  8. 1173469Domain d1rxun_: 1rxu N: [98050]
    complexed with k, po4, thm

Details for d1rxun_

PDB Entry: 1rxu (more details), 3.1 Å

PDB Description: E. coli uridine phosphorylase: thymidine phosphate complex
PDB Compounds: (N:) Uridine phosphorylase

SCOPe Domain Sequences for d1rxun_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rxun_ c.56.2.1 (N:) Uridine phosphorylase {Escherichia coli [TaxId: 562]}
sdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpvi
vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
aplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkgs
meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
ivveaarrll

SCOPe Domain Coordinates for d1rxun_:

Click to download the PDB-style file with coordinates for d1rxun_.
(The format of our PDB-style files is described here.)

Timeline for d1rxun_: