Lineage for d1rxui_ (1rxu I:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 488901Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 488917Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 488918Family c.56.2.1: Purine and uridine phosphorylases [53168] (6 proteins)
  6. 489168Protein Uridine phosphorylase [53176] (1 species)
  7. 489169Species Escherichia coli [TaxId:562] [53177] (6 PDB entries)
    also includes the PDB entry (1rxs) where protein chains are designated by both upper case and lower case letters creating problems with its processing and presentation in SCOP
  8. 489196Domain d1rxui_: 1rxu I: [98045]

Details for d1rxui_

PDB Entry: 1rxu (more details), 3.1 Å

PDB Description: E. coli uridine phosphorylase: thymidine phosphate complex

SCOP Domain Sequences for d1rxui_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rxui_ c.56.2.1 (I:) Uridine phosphorylase {Escherichia coli}
sdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpvi
vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
aplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkgs
meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
ivveaarrll

SCOP Domain Coordinates for d1rxui_:

Click to download the PDB-style file with coordinates for d1rxui_.
(The format of our PDB-style files is described here.)

Timeline for d1rxui_: