Lineage for d1rxma2 (1rxm A:123-245)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1218783Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 1218784Superfamily d.131.1: DNA clamp [55979] (2 families) (S)
  5. 1218849Family d.131.1.2: DNA polymerase processivity factor [55983] (4 proteins)
    duplication: consists of two domains of this fold
  6. 1218871Protein Proliferating cell nuclear antigen (PCNA) [55989] (5 species)
  7. 1218872Species Archaeoglobus fulgidus [TaxId:2234] [103254] (3 PDB entries)
  8. 1218878Domain d1rxma2: 1rxm A:123-245 [98036]
    complexed with a FEN-1 peptide, chain B

Details for d1rxma2

PDB Entry: 1rxm (more details), 2.8 Å

PDB Description: C-terminal region of FEN-1 bound to A. fulgidus PCNA
PDB Compounds: (A:) DNA polymerase sliding clamp

SCOPe Domain Sequences for d1rxma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rxma2 d.131.1.2 (A:123-245) Proliferating cell nuclear antigen (PCNA) {Archaeoglobus fulgidus [TaxId: 2234]}
pelelpakivmdagefkkaiaaadkisdqvifrsdkegfrieakgdvdsivfhmteteli
efnggearsmfsvdylkefckvagsgdlltihlgtnypvrlvfelvggrakveyilapri
ese

SCOPe Domain Coordinates for d1rxma2:

Click to download the PDB-style file with coordinates for d1rxma2.
(The format of our PDB-style files is described here.)

Timeline for d1rxma2: