Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) |
Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins) duplication: consists of two domains of this fold |
Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species) |
Species Archaeoglobus fulgidus [TaxId:2234] [103254] (3 PDB entries) |
Domain d1rxma2: 1rxm A:123-245 [98036] complexed with a FEN-1 peptide, chain B |
PDB Entry: 1rxm (more details), 2.8 Å
SCOPe Domain Sequences for d1rxma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rxma2 d.131.1.2 (A:123-245) Proliferating cell nuclear antigen (PCNA) {Archaeoglobus fulgidus [TaxId: 2234]} pelelpakivmdagefkkaiaaadkisdqvifrsdkegfrieakgdvdsivfhmteteli efnggearsmfsvdylkefckvagsgdlltihlgtnypvrlvfelvggrakveyilapri ese
Timeline for d1rxma2: