| Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
| Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (2 families) ![]() |
| Family d.131.1.2: DNA polymerase processivity factor [55983] (4 proteins) duplication: consists of two domains of this fold |
| Protein Proliferating cell nuclear antigen (PCNA) [55989] (5 species) |
| Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [103254] (3 PDB entries) |
| Domain d1rxma1: 1rxm A:1-122 [98035] |
PDB Entry: 1rxm (more details), 2.8 Å
SCOP Domain Sequences for d1rxma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rxma1 d.131.1.2 (A:1-122) Proliferating cell nuclear antigen (PCNA) {Archaeon Archaeoglobus fulgidus}
midvimtgellktvtraivalvsearihflekglhsravdpanvamvivdipkdsfevyn
ideektigvdmdrifdisksistkdlvelivedestlkvkfgsveykvalidpsairkep
ri
Timeline for d1rxma1: