Lineage for d1rxma1 (1rxm A:1-122)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 511273Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 511274Superfamily d.131.1: DNA clamp [55979] (2 families) (S)
  5. 511311Family d.131.1.2: DNA polymerase processivity factor [55983] (4 proteins)
    duplication: consists of two domains of this fold
  6. 511333Protein Proliferating cell nuclear antigen (PCNA) [55989] (5 species)
  7. 511334Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [103254] (3 PDB entries)
  8. 511339Domain d1rxma1: 1rxm A:1-122 [98035]

Details for d1rxma1

PDB Entry: 1rxm (more details), 2.8 Å

PDB Description: C-terminal region of FEN-1 bound to A. fulgidus PCNA

SCOP Domain Sequences for d1rxma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rxma1 d.131.1.2 (A:1-122) Proliferating cell nuclear antigen (PCNA) {Archaeon Archaeoglobus fulgidus}
midvimtgellktvtraivalvsearihflekglhsravdpanvamvivdipkdsfevyn
ideektigvdmdrifdisksistkdlvelivedestlkvkfgsveykvalidpsairkep
ri

SCOP Domain Coordinates for d1rxma1:

Click to download the PDB-style file with coordinates for d1rxma1.
(The format of our PDB-style files is described here.)

Timeline for d1rxma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rxma2