Lineage for d1rxja_ (1rxj A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 564717Fold b.61: Streptavidin-like [50875] (6 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 564718Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 564719Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 564742Protein Streptavidin [50878] (1 species)
  7. 564743Species Streptomyces avidinii [TaxId:1895] [50879] (113 PDB entries)
  8. 564750Domain d1rxja_: 1rxj A: [98029]

Details for d1rxja_

PDB Entry: 1rxj (more details), 1.14 Å

PDB Description: Crystal structure of streptavidin mutant (M2) where the L3,4 loop was replace by that of avidin

SCOP Domain Sequences for d1rxja_:

Sequence, based on SEQRES records: (download)

>d1rxja_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii}
gitgtwynqlgstfivtagadgaltgtyesavtatsneikryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkp

Sequence, based on observed residues (ATOM records): (download)

>d1rxja_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii}
gitgtwynqlgstfivtagadgaltgtyesakryvltgrydsapatdgsgtalgwtvawk
nnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp

SCOP Domain Coordinates for d1rxja_:

Click to download the PDB-style file with coordinates for d1rxja_.
(The format of our PDB-style files is described here.)

Timeline for d1rxja_: