Lineage for d1rxcc_ (1rxc C:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 398073Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 398089Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 398090Family c.56.2.1: Purine and uridine phosphorylases [53168] (5 proteins)
  6. 398310Protein Uridine phosphorylase [53176] (1 species)
  7. 398311Species Escherichia coli [TaxId:562] [53177] (6 PDB entries)
    also includes the PDB entry (1rxs) where protein chains are designated by both upper case and lower case letters creating problems with its processing and presentation in SCOP
  8. 398318Domain d1rxcc_: 1rxc C: [98017]

Details for d1rxcc_

PDB Entry: 1rxc (more details), 2.35 Å

PDB Description: e. coli uridine phosphorylase: 5-fluorouracil ribose-1-phosphate complex

SCOP Domain Sequences for d1rxcc_:

Sequence, based on SEQRES records: (download)

>d1rxcc_ c.56.2.1 (C:) Uridine phosphorylase {Escherichia coli}
sdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpvi
vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
aplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkgs
meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
ivveaarrll

Sequence, based on observed residues (ATOM records): (download)

>d1rxcc_ c.56.2.1 (C:) Uridine phosphorylase {Escherichia coli}
sdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpvi
vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
aplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkgs
meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipmkqteshavkivve
aarrll

SCOP Domain Coordinates for d1rxcc_:

Click to download the PDB-style file with coordinates for d1rxcc_.
(The format of our PDB-style files is described here.)

Timeline for d1rxcc_: