Lineage for d1rx0d1 (1rx0 D:241-393)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 639849Fold a.29: Bromodomain-like [47363] (10 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 639872Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (2 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 639873Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (9 proteins)
  6. 639901Protein Isobutyryl-CoA dehydrogenase [101144] (1 species)
  7. 639902Species Human (Homo sapiens) [TaxId:9606] [101145] (1 PDB entry)
  8. 639906Domain d1rx0d1: 1rx0 D:241-393 [98013]
    Other proteins in same PDB: d1rx0a2, d1rx0b2, d1rx0c2, d1rx0d2
    complexed with 2mc, acy, egl, fad

Details for d1rx0d1

PDB Entry: 1rx0 (more details), 1.77 Å

PDB Description: crystal structure of isobutyryl-coa dehydrogenase complexed with substrate/ligand.
PDB Compounds: (D:) Acyl-CoA dehydrogenase family member 8, mitochondrial

SCOP Domain Sequences for d1rx0d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rx0d1 a.29.3.1 (D:241-393) Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
gqgfliavrglnggriniascslgaahasviltrdhlnvrkqfgeplasnqylqftladm
atrlvaarlmvrnaavalqeerkdavalcsmaklfatdecfaicnqalqmhggygylkdy
avqqyvrdsrvhqilegsnevmrilisrsllqe

SCOP Domain Coordinates for d1rx0d1:

Click to download the PDB-style file with coordinates for d1rx0d1.
(The format of our PDB-style files is described here.)

Timeline for d1rx0d1: