Lineage for d1rx0c2 (1rx0 C:11-240)

  1. Root: SCOP 1.71
  2. 617324Class e: Multi-domain proteins (alpha and beta) [56572] (48 folds)
  3. 617949Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 617950Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (2 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 617951Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (7 proteins)
  6. 617969Protein Isobutyryl-CoA dehydrogenase [103394] (1 species)
  7. 617970Species Human (Homo sapiens) [TaxId:9606] [103395] (1 PDB entry)
  8. 617973Domain d1rx0c2: 1rx0 C:11-240 [98012]
    Other proteins in same PDB: d1rx0a1, d1rx0b1, d1rx0c1, d1rx0d1

Details for d1rx0c2

PDB Entry: 1rx0 (more details), 1.77 Å

PDB Description: crystal structure of isobutyryl-coa dehydrogenase complexed with substrate/ligand.

SCOP Domain Sequences for d1rx0c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rx0c2 e.6.1.1 (C:11-240) Isobutyryl-CoA dehydrogenase {Human (Homo sapiens)}
scidpsmglneeqkefqkvafdfaaremapnmaewdqkelfpvdvmrkaaqlgfggvyiq
tdvggsglsrldtsvifealatgctsttayisihnmcawmidsfgneeqrhkfcpplctm
ekfasycltepgsgsdaaslltsakkqgdhyilngskafisgagesdiyvvmcrtggpgp
kgiscivvekgtpglsfgkkekkvgwnsqptravifedcavpvanrigse

SCOP Domain Coordinates for d1rx0c2:

Click to download the PDB-style file with coordinates for d1rx0c2.
(The format of our PDB-style files is described here.)

Timeline for d1rx0c2: