![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (48 folds) |
![]() | Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
![]() | Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (2 families) ![]() flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
![]() | Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (7 proteins) |
![]() | Protein Isobutyryl-CoA dehydrogenase [103394] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [103395] (1 PDB entry) |
![]() | Domain d1rx0c2: 1rx0 C:11-240 [98012] Other proteins in same PDB: d1rx0a1, d1rx0b1, d1rx0c1, d1rx0d1 |
PDB Entry: 1rx0 (more details), 1.77 Å
SCOP Domain Sequences for d1rx0c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rx0c2 e.6.1.1 (C:11-240) Isobutyryl-CoA dehydrogenase {Human (Homo sapiens)} scidpsmglneeqkefqkvafdfaaremapnmaewdqkelfpvdvmrkaaqlgfggvyiq tdvggsglsrldtsvifealatgctsttayisihnmcawmidsfgneeqrhkfcpplctm ekfasycltepgsgsdaaslltsakkqgdhyilngskafisgagesdiyvvmcrtggpgp kgiscivvekgtpglsfgkkekkvgwnsqptravifedcavpvanrigse
Timeline for d1rx0c2: