SCOP 1.67: Domain d1rx0c2: 1rx0 C:11-240

Lineage for d1rx0c2 (1rx0 C:11-240)

1. Root: SCOP 1.67

2. Class e: Multi-domain proteins (alpha and beta) [56572] (40 folds)

3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
   2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology

4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (2 families)
   flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)

5. Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (5 proteins)

6. Protein Isobutyryl-CoA dehydrogenase [103394] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [103395] (1 PDB entry)

8. Domain d1rx0c2: 1rx0 C:11-240 [98012]
   Other proteins in same PDB: d1rx0a1, d1rx0b1, d1rx0c1, d1rx0d1

Details for d1rx0c2

PDB Entry: 1rx0, 1.77 Å

PDB Description: crystal structure of isobutyryl-coa dehydrogenase complexed with substrate/ligand.

SCOP Domain Sequences for d1rx0c2:

Sequence; same for both SEQRES and ATOM records:

>d1rx0c2 e.6.1.1 (C:11-240) Isobutyryl-CoA dehydrogenase {Human (Homo sapiens)}
scidpsmglneeqkefqkvafdfaaremapnmaewdqkelfpvdvmrkaaqlgfggvyiq
tdvggsglsrldtsvifealatgctsttayisihnmcawmidsfgneeqrhkfcpplctm
ekfasycltepgsgsdaaslltsakkqgdhyilngskafisgagesdiyvvmcrtggpgp
kgiscivvekgtpglsfgkkekkvgwnsqptravifedcavpvanrigse

Timeline for d1rx0c2:

• d1rx0c2 is new in SCOP 1.67
  
• d1rx0c2 appears in SCOP 1.69
  
• d1rx0c2 appears in the current release, SCOPe 2.08