SCOPe 2.05: Domain d1rx0c1: 1rx0 C:241-393

Lineage for d1rx0c1 (1rx0 C:241-393)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins)

6. Protein Isobutyryl-CoA dehydrogenase [101144] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101145] (1 PDB entry)

8. Domain d1rx0c1: 1rx0 C:241-393 [98011]
   Other proteins in same PDB: d1rx0a2, d1rx0b2, d1rx0c2, d1rx0d2
   complexed with 2mc, acy, edo, fad

Details for d1rx0c1

PDB Entry: 1rx0, 1.77 Å

PDB Description: crystal structure of isobutyryl-coa dehydrogenase complexed with substrate/ligand.

PDB Compounds: (C:) Acyl-CoA dehydrogenase family member 8, mitochondrial

SCOPe Domain Sequences for d1rx0c1:

Sequence; same for both SEQRES and ATOM records:

>d1rx0c1 a.29.3.1 (C:241-393) Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
gqgfliavrglnggriniascslgaahasviltrdhlnvrkqfgeplasnqylqftladm
atrlvaarlmvrnaavalqeerkdavalcsmaklfatdecfaicnqalqmhggygylkdy
avqqyvrdsrvhqilegsnevmrilisrsllqe

Timeline for d1rx0c1:

• d1rx0c1 first appeared in SCOP 1.67
  
• d1rx0c1 appears in SCOPe 2.04
  
• d1rx0c1 appears in SCOPe 2.06
  
• d1rx0c1 appears in the current release, SCOPe 2.08