Lineage for d1rx0a1 (1rx0 A:241-393)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1731436Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1731940Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 1731941Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins)
  6. 1731970Protein Isobutyryl-CoA dehydrogenase [101144] (1 species)
  7. 1731971Species Human (Homo sapiens) [TaxId:9606] [101145] (1 PDB entry)
  8. 1731972Domain d1rx0a1: 1rx0 A:241-393 [98007]
    Other proteins in same PDB: d1rx0a2, d1rx0b2, d1rx0c2, d1rx0d2
    complexed with 2mc, acy, edo, fad

Details for d1rx0a1

PDB Entry: 1rx0 (more details), 1.77 Å

PDB Description: crystal structure of isobutyryl-coa dehydrogenase complexed with substrate/ligand.
PDB Compounds: (A:) Acyl-CoA dehydrogenase family member 8, mitochondrial

SCOPe Domain Sequences for d1rx0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rx0a1 a.29.3.1 (A:241-393) Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
gqgfliavrglnggriniascslgaahasviltrdhlnvrkqfgeplasnqylqftladm
atrlvaarlmvrnaavalqeerkdavalcsmaklfatdecfaicnqalqmhggygylkdy
avqqyvrdsrvhqilegsnevmrilisrsllqe

SCOPe Domain Coordinates for d1rx0a1:

Click to download the PDB-style file with coordinates for d1rx0a1.
(The format of our PDB-style files is described here.)

Timeline for d1rx0a1: