Lineage for d1rwza1 (1rwz A:1-122)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2539893Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2539894Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2540079Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. 2540101Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species)
  7. 2540102Species Archaeoglobus fulgidus [TaxId:2234] [103254] (3 PDB entries)
  8. 2540103Domain d1rwza1: 1rwz A:1-122 [98005]

Details for d1rwza1

PDB Entry: 1rwz (more details), 1.8 Å

PDB Description: Crystal Structure of Proliferating Cell Nuclear Antigen (PCNA) from A. fulgidus
PDB Compounds: (A:) DNA polymerase sliding clamp

SCOPe Domain Sequences for d1rwza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rwza1 d.131.1.2 (A:1-122) Proliferating cell nuclear antigen (PCNA) {Archaeoglobus fulgidus [TaxId: 2234]}
midvimtgellktvtraivalvsearihflekglhsravdpanvamvivdipkdsfevyn
ideektigvdmdrifdisksistkdlvelivedestlkvkfgsveykvalidpsairkep
ri

SCOPe Domain Coordinates for d1rwza1:

Click to download the PDB-style file with coordinates for d1rwza1.
(The format of our PDB-style files is described here.)

Timeline for d1rwza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rwza2