Lineage for d1rwyc_ (1rwy C:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 442523Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 442524Superfamily a.39.1: EF-hand [47473] (10 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 442659Family a.39.1.4: Parvalbumin [47492] (2 proteins)
    6-helices; array of 3 hairpins, closed
    made with two-helical hairpin and two EF-hands
  6. 442664Protein Parvalbumin [47495] (7 species)
  7. 442690Species Rat (Rattus rattus) [TaxId:10117] [47501] (4 PDB entries)
  8. 442693Domain d1rwyc_: 1rwy C: [98004]

Details for d1rwyc_

PDB Entry: 1rwy (more details), 1.05 Å

PDB Description: crystal structure of rat alpha-parvalbumin at 1.05 resolution

SCOP Domain Sequences for d1rwyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rwyc_ a.39.1.4 (C:) Parvalbumin {Rat (Rattus rattus)}
smtdllsaedikkaigaftaadsfdhkkffqmvglkkksaddvkkvfhildkdksgfiee
delgsilkgfssdardlsaketktlmaagdkdgdgkigveefstlvaes

SCOP Domain Coordinates for d1rwyc_:

Click to download the PDB-style file with coordinates for d1rwyc_.
(The format of our PDB-style files is described here.)

Timeline for d1rwyc_: