| Class a: All alpha proteins [46456] (202 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (10 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.4: Parvalbumin [47492] (2 proteins) 6-helices; array of 3 hairpins, closed made with two-helical hairpin and two EF-hands |
| Protein Parvalbumin [47495] (6 species) |
| Species Rat (Rattus rattus) [TaxId:10117] [47501] (3 PDB entries) |
| Domain d1rwyc_: 1rwy C: [98004] complexed with acy, ca, nh4, pg4, so4 |
PDB Entry: 1rwy (more details), 1.05 Å
SCOP Domain Sequences for d1rwyc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rwyc_ a.39.1.4 (C:) Parvalbumin {Rat (Rattus rattus)}
smtdllsaedikkaigaftaadsfdhkkffqmvglkkksaddvkkvfhildkdksgfiee
delgsilkgfssdardlsaketktlmaagdkdgdgkigveefstlvaes
Timeline for d1rwyc_: